| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
| Protein automated matches [254586] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [341681] (5 PDB entries) |
| Domain d5wkph_: 5wkp H: [341691] Other proteins in same PDB: d5wkpa1, d5wkpa2, d5wkpb_, d5wkpc_, d5wkpe1, d5wkpe2, d5wkpf_, d5wkpg_ automated match to d2l4xa_ complexed with 8q1, plp |
PDB Entry: 5wkp (more details), 3.15 Å
SCOPe Domain Sequences for d5wkph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wkph_ d.224.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstqvvdhyenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfg
cgsaiassslatewvkgktveealtikntdiakelclppvklhcsilaedaikaaladyk
lkqepk
Timeline for d5wkph_: