SCOPe 2.08: Domain d5wlge2: 5wlg E:115-243

Lineage for d5wlge2 (5wlg E:115-243)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wlge2: 5wlg E:115-243 [341688]
   Other proteins in same PDB: d5wlga1, d5wlgb_, d5wlgd2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi2
   automated match to d2vlme2
   complexed with cl, na

Details for d5wlge2

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (E:) T-cell receptor beta chain V region C5,Human nkt tcr beta chain

SCOPe Domain Sequences for d5wlge2:

Sequence; same for both SEQRES and ATOM records:

>d5wlge2 b.1.1.0 (E:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d5wlge2:

• d5wlge2 first appeared in SCOPe 2.06
  
• d5wlge2 appears in SCOPe 2.07