Lineage for d5wlga1 (5wlg A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937997Species Mouse (Mus musculus) [TaxId:10090] [226600] (3 PDB entries)
  8. 2938000Domain d5wlga1: 5wlg A:1-181 [341751]
    Other proteins in same PDB: d5wlga2, d5wlgb_, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf2, d5wlgg_, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2
    automated match to d1kjva2
    complexed with cl, na

Details for d5wlga1

PDB Entry: 5wlg (more details), 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5wlga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wlga1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d5wlga1:

Click to download the PDB-style file with coordinates for d5wlga1.
(The format of our PDB-style files is described here.)

Timeline for d5wlga1: