![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
![]() | Domain d5wlgb_: 5wlg B: [341659] Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf1, d5wlgf2, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2 automated match to d1p4lb_ complexed with cl, na |
PDB Entry: 5wlg (more details), 2.1 Å
SCOPe Domain Sequences for d5wlgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wlgb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d5wlgb_: