Lineage for d5wlgf2 (5wlg F:182-277)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349724Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2349812Domain d5wlgf2: 5wlg F:182-277 [341657]
    Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf1, d5wlgg_, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2
    automated match to d1kjva1
    complexed with cl, na

Details for d5wlgf2

PDB Entry: 5wlg (more details), 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)
PDB Compounds: (F:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5wlgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wlgf2 b.1.1.2 (F:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

SCOPe Domain Coordinates for d5wlgf2:

Click to download the PDB-style file with coordinates for d5wlgf2.
(The format of our PDB-style files is described here.)

Timeline for d5wlgf2: