| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
| Domain d5wlgf2: 5wlg F:182-277 [341657] Other proteins in same PDB: d5wlga1, d5wlga2, d5wlgb_, d5wlgd1, d5wlgd2, d5wlge1, d5wlge2, d5wlgf1, d5wlgg_, d5wlgi1, d5wlgi2, d5wlgj1, d5wlgj2 automated match to d1kjva1 complexed with cl, na |
PDB Entry: 5wlg (more details), 2.1 Å
SCOPe Domain Sequences for d5wlgf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wlgf2 b.1.1.2 (F:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp
Timeline for d5wlgf2: