| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
| Domain d4lgsb_: 4lgs B: [341508] Other proteins in same PDB: d4lgsa_ automated match to d4heme_ |
PDB Entry: 4lgs (more details), 2.7 Å
SCOPe Domain Sequences for d4lgsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lgsb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslslscaasggdfsrnamawfrqapgkerefvasinwtgsgtyy
ldsvkgrftisrdnaknalylqmnnlkpedtavyycarstvfaeitglagyqsgsydywg
qgtqvtvss
Timeline for d4lgsb_: