SCOPe 2.08: Domain d4lgsb_: 4lgs B:

Lineage for d4lgsb_ (4lgs B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d4lgsb_: 4lgs B: [341508]
   Other proteins in same PDB: d4lgsa_
   automated match to d4heme_

Details for d4lgsb_

PDB Entry: 4lgs, 2.7 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh4)

PDB Compounds: (B:) Camelid nanobody (VHH4)

SCOPe Domain Sequences for d4lgsb_:

Sequence; same for both SEQRES and ATOM records:

>d4lgsb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslslscaasggdfsrnamawfrqapgkerefvasinwtgsgtyy
ldsvkgrftisrdnaknalylqmnnlkpedtavyycarstvfaeitglagyqsgsydywg
qgtqvtvss

Timeline for d4lgsb_:

• d4lgsb_ first appeared in SCOPe 2.06
  
• d4lgsb_ appears in SCOPe 2.07