Lineage for d4lgsb_ (4lgs B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745613Domain d4lgsb_: 4lgs B: [341508]
    Other proteins in same PDB: d4lgsa_
    automated match to d4heme_

Details for d4lgsb_

PDB Entry: 4lgs (more details), 2.7 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh4)
PDB Compounds: (B:) Camelid nanobody (VHH4)

SCOPe Domain Sequences for d4lgsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lgsb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslslscaasggdfsrnamawfrqapgkerefvasinwtgsgtyy
ldsvkgrftisrdnaknalylqmnnlkpedtavyycarstvfaeitglagyqsgsydywg
qgtqvtvss

SCOPe Domain Coordinates for d4lgsb_:

Click to download the PDB-style file with coordinates for d4lgsb_.
(The format of our PDB-style files is described here.)

Timeline for d4lgsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lgsa_