Lineage for d4heme_ (4hem E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355913Domain d4heme_: 4hem E: [202415]
    Other proteins in same PDB: d4hema1, d4hemb1, d4hemc1
    automated match to d4hemf_

Details for d4heme_

PDB Entry: 4hem (more details), 1.65 Å

PDB Description: llama vhh-02 binder of orf49 (rbp) from lactococcal phage tp901-1
PDB Compounds: (E:) Anti-baseplate TP901-1 Llama vHH 02

SCOPe Domain Sequences for d4heme_:

Sequence, based on SEQRES records: (download)

>d4heme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
vss

Sequence, based on observed residues (ATOM records): (download)

>d4heme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasestfsnyamgwfrqaperefvatisqtgshtyyrn
svkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvtvs
s

SCOPe Domain Coordinates for d4heme_:

Click to download the PDB-style file with coordinates for d4heme_.
(The format of our PDB-style files is described here.)

Timeline for d4heme_: