Lineage for d5l03b_ (5l03 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202094Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2202231Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 2202232Protein automated matches [190884] (7 species)
    not a true protein
  7. 2202243Species Burkholderia pseudomallei [TaxId:28450] [255823] (12 PDB entries)
  8. 2202251Domain d5l03b_: 5l03 B: [341240]
    automated match to d3f0da_
    complexed with 6zb, zn

Details for d5l03b_

PDB Entry: 5l03 (more details), 1.47 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei bound to l-tryptophan hydroxamate
PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5l03b_:

Sequence, based on SEQRES records: (download)

>d5l03b_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvr

Sequence, based on observed residues (ATOM records): (download)

>d5l03b_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyerglladvllhaitdalfgaaalgdigrhfd
srallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpldrvnvkak
tneklgylgrgegieaqaaalvvr

SCOPe Domain Coordinates for d5l03b_:

Click to download the PDB-style file with coordinates for d5l03b_.
(The format of our PDB-style files is described here.)

Timeline for d5l03b_: