Lineage for d5xupa_ (5xup A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340570Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2340571Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2340572Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 protein domains)
  6. 2340573Protein TRF1 [63602] (1 species)
  7. 2340574Species Human (Homo sapiens) [TaxId:9606] [63603] (3 PDB entries)
  8. 2340576Domain d5xupa_: 5xup A: [341112]
    automated match to d3bqoa_

Details for d5xupa_

PDB Entry: 5xup (more details), 2.1 Å

PDB Description: crystal structure of trf1 and terb1
PDB Compounds: (A:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d5xupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xupa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv
nyvlseksstflmkaaakvves

SCOPe Domain Coordinates for d5xupa_:

Click to download the PDB-style file with coordinates for d5xupa_.
(The format of our PDB-style files is described here.)

Timeline for d5xupa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xupb_