SCOPe 2.08: Domain d5xupa_: 5xup A:

Lineage for d5xupa_ (5xup A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
   multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain

4. Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family)
   automatically mapped to Pfam PF08558

5. Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)

6. Protein TRF1 [63602] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63603] (4 PDB entries)

8. Domain d5xupa_: 5xup A: [341112]
   automated match to d3bqoa_

Details for d5xupa_

PDB Entry: 5xup, 2.1 Å

PDB Description: crystal structure of trf1 and terb1

PDB Compounds: (A:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d5xupa_:

Sequence; same for both SEQRES and ATOM records:

>d5xupa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv
nyvlseksstflmkaaakvves

Timeline for d5xupa_:

• d5xupa_ first appeared in SCOPe 2.06
  
• d5xupa_ appears in SCOPe 2.07