Lineage for d3bqoa_ (3bqo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734969Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2734970Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2734971Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)
  6. 2734972Protein TRF1 [63602] (1 species)
  7. 2734973Species Human (Homo sapiens) [TaxId:9606] [63603] (4 PDB entries)
  8. 2734974Domain d3bqoa_: 3bqo A: [155503]
    automated match to d3bqoa1
    protein/DNA complex

Details for d3bqoa_

PDB Entry: 3bqo (more details), 2 Å

PDB Description: Crystal Structure of TRF1 TRFH domain and TIN2 peptide complex
PDB Compounds: (A:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d3bqoa_:

Sequence, based on SEQRES records: (download)

>d3bqoa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
avcmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekik
syvnyvlseksstflmkaaakvveskr

Sequence, based on observed residues (ATOM records): (download)

>d3bqoa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
avcmengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvny
vlseksstflmkaaakvveskr

SCOPe Domain Coordinates for d3bqoa_:

Click to download the PDB-style file with coordinates for d3bqoa_.
(The format of our PDB-style files is described here.)

Timeline for d3bqoa_: