Lineage for d5xupb_ (5xup B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)
  6. Protein TRF1 [63602] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63603] (4 PDB entries)
  8. Domain d5xupb_: 5xup B: [341120]
    automated match to d3bqoa_

Details for d5xupb_

PDB Entry: 5xup (more details), 2.1 Å

PDB Description: crystal structure of trf1 and terb1
PDB Compounds: (B:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d5xupb_:

Sequence, based on SEQRES records: (download)

>d5xupb_ a.146.1.1 (B:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv
nyvlseksstflmkaaakvve

Sequence, based on observed residues (ATOM records): (download)

>d5xupb_ a.146.1.1 (B:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
mengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvnyvls
eksstflmkaaakvve

SCOPe Domain Coordinates for d5xupb_ are not available.

Timeline for d5xupb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xupa_