![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily) multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain |
![]() | Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) ![]() automatically mapped to Pfam PF08558 |
![]() | Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins) |
![]() | Protein TRF1 [63602] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63603] (4 PDB entries) |
![]() | Domain d5xupb_: 5xup B: [341120] automated match to d3bqoa_ |
PDB Entry: 5xup (more details), 2.1 Å
SCOPe Domain Sequences for d5xupb_:
Sequence, based on SEQRES records: (download)
>d5xupb_ a.146.1.1 (B:) TRF1 {Human (Homo sapiens) [TaxId: 9606]} glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv nyvlseksstflmkaaakvve
>d5xupb_ a.146.1.1 (B:) TRF1 {Human (Homo sapiens) [TaxId: 9606]} glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc mengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvnyvls eksstflmkaaakvve
Timeline for d5xupb_: