SCOPe 2.07: Domain d6amqa2: 6amq A:123-244

Lineage for d6amqa2 (6amq A:123-244)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Enterobacter cloacae [TaxId:1045856] [340820] (1 PDB entry)

8. Domain d6amqa2: 6amq A:123-244 [340837]
   automated match to d1ok7a2
   complexed with so4

Details for d6amqa2

PDB Entry: 6amq, 2.67 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from enterobacter cloacae

PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6amqa2:

Sequence; same for both SEQRES and ATOM records:

>d6amqa2 d.131.1.0 (A:123-244) automated matches {Enterobacter cloacae [TaxId: 1045856]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigdslpnhsvivprkgvielmrmldggdtplrvqigsnnirahvgdfvftsklvdgrfp
dy

Timeline for d6amqa2:

• d6amqa2 first appeared in SCOPe 2.06
  
• d6amqa2 appears in the current release, SCOPe 2.08