Lineage for d6amqd1 (6amq D:1-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583867Species Enterobacter cloacae [TaxId:1045856] [340820] (1 PDB entry)
  8. 2583877Domain d6amqd1: 6amq D:1-122 [341048]
    automated match to d1ok7a1
    complexed with so4

Details for d6amqd1

PDB Entry: 6amq (more details), 2.67 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from enterobacter cloacae
PDB Compounds: (D:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6amqd1:

Sequence, based on SEQRES records: (download)

>d6amqd1 d.131.1.0 (D:1-122) automated matches {Enterobacter cloacae [TaxId: 1045856]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememiarvtls
qpheagattvparkffdicrglpegaeiavqlegdrmlvrsgrsrfslstlpaadfpnld
dw

Sequence, based on observed residues (ATOM records): (download)

>d6amqd1 d.131.1.0 (D:1-122) automated matches {Enterobacter cloacae [TaxId: 1045856]}
mkftverehllkplqqvsgplpilgnlllqvadgtlsltgtdlememiarvtlsqpheag
attvparkffdicrglpegaeiavqlegdrmlvrsgrsrfslstlpaadfpnlddw

SCOPe Domain Coordinates for d6amqd1:

Click to download the PDB-style file with coordinates for d6amqd1.
(The format of our PDB-style files is described here.)

Timeline for d6amqd1: