| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (28 species) not a true protein |
| Species Enterobacter cloacae [TaxId:1045856] [340820] (1 PDB entry) |
| Domain d6amqb3: 6amq B:245-365 [340842] automated match to d1ok7a3 complexed with so4 |
PDB Entry: 6amq (more details), 2.67 Å
SCOPe Domain Sequences for d6amqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6amqb3 d.131.1.0 (B:245-365) automated matches {Enterobacter cloacae [TaxId: 1045856]}
rrvlpknpdktleagcdslkqafaraailsnekfrgvrlyvsenqikitannpeqeeaee
ildvtyagtemeigfnvsyvldvlnalkcenvrilltdsvssvqiedaasqsaayvvmpm
r
Timeline for d6amqb3: