Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries) |
Domain d5xi5f1: 5xi5 F:1-76 [340382] Other proteins in same PDB: d5xi5a1, d5xi5a2, d5xi5b1, d5xi5b2, d5xi5c1, d5xi5c2, d5xi5d1, d5xi5d2, d5xi5e_, d5xi5f2, d5xi5f3 automated match to d3tiia1 complexed with acp, ca, gdp, gtp, mes, mg, pn6 |
PDB Entry: 5xi5 (more details), 2.81 Å
SCOPe Domain Sequences for d5xi5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xi5f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5xi5f1: