Lineage for d5xi5d2 (5xi5 D:244-431)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2960015Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)
  8. 2960037Domain d5xi5d2: 5xi5 D:244-431 [340362]
    Other proteins in same PDB: d5xi5a1, d5xi5b1, d5xi5c1, d5xi5d1, d5xi5e_, d5xi5f1, d5xi5f2, d5xi5f3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5xi5d2

PDB Entry: 5xi5 (more details), 2.81 Å

PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5xi5d2:

Sequence, based on SEQRES records: (download)

>d5xi5d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5xi5d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5xi5d2:

Click to download the PDB-style file with coordinates for d5xi5d2.
(The format of our PDB-style files is described here.)

Timeline for d5xi5d2: