Lineage for d5xi5f3 (5xi5 F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (79 PDB entries)
  8. 2541776Domain d5xi5f3: 5xi5 F:77-378 [344450]
    Other proteins in same PDB: d5xi5a1, d5xi5a2, d5xi5b1, d5xi5b2, d5xi5c1, d5xi5c2, d5xi5d1, d5xi5d2, d5xi5e_, d5xi5f1, d5xi5f2
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5xi5f3

PDB Entry: 5xi5 (more details), 2.81 Å

PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5xi5f3:

Sequence, based on SEQRES records: (download)

>d5xi5f3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5xi5f3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviypgnvwiaksgilisseahviqkylekplllepghr
kfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqknygryeegne
mffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmv
deelkvwlievngapacaqklyaelcqgivdvaissvfplasifikl

SCOPe Domain Coordinates for d5xi5f3:

Click to download the PDB-style file with coordinates for d5xi5f3.
(The format of our PDB-style files is described here.)

Timeline for d5xi5f3:

  • d5xi5f3 is new in SCOPe 2.07-stable