Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (25 species) not a true protein |
Species Influenza A virus [TaxId:11320] [187142] (23 PDB entries) |
Domain d6aoqa1: 6aoq A:11-325 [340236] Other proteins in same PDB: d6aoqa2, d6aoqb_ automated match to d2yp5a1 complexed with bma, man, nag |
PDB Entry: 6aoq (more details), 2.35 Å
SCOPe Domain Sequences for d6aoqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aoqa1 b.19.1.2 (A:11-325) automated matches {Influenza A virus [TaxId: 11320]} atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd qiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk qntlklatgmrnvpe
Timeline for d6aoqa1: