SCOPe 2.08: Domain d6aoqa1: 6aoq A:11-325

Lineage for d6aoqa1 (6aoq A:11-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d6aoqa1: 6aoq A:11-325 [340236]
   Other proteins in same PDB: d6aoqa2, d6aoqb_
   automated match to d2yp5a1
   complexed with nag

Details for d6aoqa1

PDB Entry: 6aoq, 2.35 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin apo form

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6aoqa1:

Sequence; same for both SEQRES and ATOM records:

>d6aoqa1 b.19.1.2 (A:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd
qiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6aoqa1:

• d6aoqa1 first appeared in SCOPe 2.06
  
• d6aoqa1 appears in SCOPe 2.07