PDB entry 6aoq

View 6aoq on RCSB PDB site
Description: Crystal structure of the A/Brisbane/10/2007 (H3N2) influenza virus hemagglutinin apo form
Class: viral protein
Keywords: Influenza A virus, hemagglutinin, mutant, receptor binding, antigenicity, VIRAL PROTEIN
Deposited on 2017-08-16, released 2017-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:476294]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8W891 (4-End)
      • expression tag (2-3)
      • variant (187)
    Domains in SCOPe 2.06: d6aoqa1, d6aoqa2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (A/Brisbane/10/2007(H3N2)) [TaxId:476294]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6aoqb_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aoqA (A:)
    anpgatlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wtgvtqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpg
    tdndqiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacp
    ryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aoqA (A:)
    pgatlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlid
    allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwt
    gvtqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtd
    ndqiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinst
    gnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpry
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aoqB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aoqB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi