Lineage for d1dkoa_ (1dko A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25819Family c.60.1.3: Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53262] (1 protein)
  6. 25820Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (3 species)
  7. 25826Species Escherichia coli [TaxId:562] [53266] (6 PDB entries)
  8. 25832Domain d1dkoa_: 1dko A: [34001]

Details for d1dkoa_

PDB Entry: 1dko (more details), 2.38 Å

PDB Description: crystal structure of tungstate complex of escherichia coli phytase at ph 6.6 with tungstate bound at the active site and with hg2+ cation acting as an intermolecular bridge

SCOP Domain Sequences for d1dkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkoa_ c.60.1.3 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli}
qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss
pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl

SCOP Domain Coordinates for d1dkoa_:

Click to download the PDB-style file with coordinates for d1dkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dkoa_: