Lineage for d5h09a1 (5h09 A:86-146)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783072Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2783073Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2783081Domain d5h09a1: 5h09 A:86-146 [339777]
    Other proteins in same PDB: d5h09a2, d5h09a3, d5h09a4
    automated match to d1qcfa1
    complexed with ooo

Details for d5h09a1

PDB Entry: 5h09 (more details), 1.95 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-ethyl2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-4-methylpentanoate
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h09a1 b.34.2.1 (A:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d5h09a1:

Click to download the PDB-style file with coordinates for d5h09a1.
(The format of our PDB-style files is described here.)

Timeline for d5h09a1: