PDB entry 5h09

View 5h09 on RCSB PDB site
Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor (S)-ethyl2-(((1r,4S)-4-(4-amino-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexyl)amino)-4-methylpentanoate
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-10-04, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (8-453)
      • linker (7)
      • engineered mutation (450-452)
    Domains in SCOPe 2.07: d5h09a1, d5h09a2, d5h09a3, d5h09a4
  • Heterogens: OOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h09A (A:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h09A (A:)
    riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
    eteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhyk
    irtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdaweipr
    eslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdklvk
    lhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrnyih
    rdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfgsftiksd
    vwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpe
    erptfeyiqsvlddfytatesqyeeip