SCOPe 2.08: Domain d5h09a3: 5h09 A:250-531

Lineage for d5h09a3 (5h09 A:250-531)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries)

8. Domain d5h09a3: 5h09 A:250-531 [339779]
   Other proteins in same PDB: d5h09a1, d5h09a2, d5h09a4
   automated match to d1qcfa3
   complexed with ooo

Details for d5h09a3

PDB Entry: 5h09, 1.95 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-ethyl2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-4-methylpentanoate

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h09a3:

Sequence; same for both SEQRES and ATOM records:

>d5h09a3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Timeline for d5h09a3:

• d5h09a3 first appeared in SCOPe 2.06
  
• d5h09a3 appears in SCOPe 2.07