SCOPe 2.06: Domain d1do8a2: 1do8 A:21-279

Lineage for d1do8a2 (1do8 A:21-279)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1do8a2: 1do8 A:21-279 [33937]
   Other proteins in same PDB: d1do8a1, d1do8b3, d1do8c3, d1do8d3
   complexed with mn, nad, oxl

Details for d1do8a2

PDB Entry: 1do8, 2.2 Å

PDB Description: crystal structure of a closed form of human mitochondrial nad(p)+- dependent malic enzyme

PDB Compounds: (A:) malic enzyme

SCOPe Domain Sequences for d1do8a2:

Sequence; same for both SEQRES and ATOM records:

>d1do8a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

Timeline for d1do8a2:

• d1do8a2 first appeared (with stable ids) in SCOP 1.55
  
• d1do8a2 appears in SCOPe 2.05
  
• d1do8a2 appears in SCOPe 2.07
  
• d1do8a2 appears in the current release, SCOPe 2.08