| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
| Domain d5nvvb1: 5nvv B:17-112 [339224] Other proteins in same PDB: d5nvva_, d5nvvb2, d5nvvc_, d5nvvd_, d5nvve2, d5nvvf_, d5nvvg_, d5nvvh2, d5nvvi_, d5nvvj_, d5nvvk2, d5nvvl_ automated match to d1lm8c_ complexed with 9bt |
PDB Entry: 5nvv (more details), 2.1 Å
SCOPe Domain Sequences for d5nvvb1:
Sequence, based on SEQRES records: (download)
>d5nvvb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d5nvvb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
Timeline for d5nvvb1: