Lineage for d5nvvf_ (5nvv F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768840Domain d5nvvf_: 5nvv F: [339250]
    Other proteins in same PDB: d5nvva_, d5nvvb1, d5nvvb2, d5nvvd_, d5nvve1, d5nvve2, d5nvvg_, d5nvvh1, d5nvvh2, d5nvvj_, d5nvvk1, d5nvvk2
    automated match to d1lqbc_
    complexed with 9bt

Details for d5nvvf_

PDB Entry: 5nvv (more details), 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-4-hydroxy-1-((s)-2-(2- hydroxyacetamido)-3,3-dimethylbutanoyl)-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nvvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvvf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d5nvvf_:

Click to download the PDB-style file with coordinates for d5nvvf_.
(The format of our PDB-style files is described here.)

Timeline for d5nvvf_: