| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
| Domain d5nvvg_: 5nvv G: [339201] Other proteins in same PDB: d5nvvb1, d5nvvb2, d5nvvc_, d5nvve1, d5nvve2, d5nvvf_, d5nvvh1, d5nvvh2, d5nvvi_, d5nvvk1, d5nvvk2, d5nvvl_ automated match to d1lqba_ complexed with 9bt |
PDB Entry: 5nvv (more details), 2.1 Å
SCOPe Domain Sequences for d5nvvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvvg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d5nvvg_: