![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Elongin C [54699] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
![]() | Domain d5nvvh1: 5nvv H:17-112 [339292] Other proteins in same PDB: d5nvva_, d5nvvb2, d5nvvc_, d5nvvd_, d5nvve2, d5nvvf_, d5nvvg_, d5nvvh2, d5nvvi_, d5nvvj_, d5nvvk2, d5nvvl_ automated match to d1lm8c_ complexed with 9bt |
PDB Entry: 5nvv (more details), 2.1 Å
SCOPe Domain Sequences for d5nvvh1:
Sequence, based on SEQRES records: (download)
>d5nvvh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d5nvvh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt nssteipefpiapeialellmaanfldc
Timeline for d5nvvh1: