| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries) |
| Domain d5nvyd_: 5nvy D: [339153] Other proteins in same PDB: d5nvyb1, d5nvyb2, d5nvyc_, d5nvye1, d5nvye2, d5nvyf_, d5nvyh1, d5nvyh2, d5nvyi_, d5nvyk1, d5nvyk2, d5nvyl_ automated match to d1lqba_ complexed with 9b5 |
PDB Entry: 5nvy (more details), 2.9 Å
SCOPe Domain Sequences for d5nvyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvyd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d5nvyd_: