| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries) |
| Domain d5nvyh1: 5nvy H:17-112 [339142] Other proteins in same PDB: d5nvya_, d5nvyb2, d5nvyc_, d5nvyd_, d5nvye2, d5nvyf_, d5nvyg_, d5nvyh2, d5nvyi_, d5nvyj_, d5nvyk2, d5nvyl_ automated match to d1lm8c_ complexed with 9b5 |
PDB Entry: 5nvy (more details), 2.9 Å
SCOPe Domain Sequences for d5nvyh1:
Sequence, based on SEQRES records: (download)
>d5nvyh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d5nvyh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc
Timeline for d5nvyh1: