Lineage for d5nvyl_ (5nvy L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041665Protein VHL [49470] (1 species)
  7. 2041666Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries)
  8. 2041765Domain d5nvyl_: 5nvy L: [339114]
    Other proteins in same PDB: d5nvya_, d5nvyb1, d5nvyb2, d5nvyd_, d5nvye1, d5nvye2, d5nvyg_, d5nvyh1, d5nvyh2, d5nvyj_, d5nvyk1, d5nvyk2
    automated match to d1lqbc_
    complexed with 9b5

Details for d5nvyl_

PDB Entry: 5nvy (more details), 2.9 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamidopropanoyl)-4- hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl) pyrrolidine-2-carboxamide (ligand 11)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nvyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvyl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d5nvyl_:

Click to download the PDB-style file with coordinates for d5nvyl_.
(The format of our PDB-style files is described here.)

Timeline for d5nvyl_: