SCOPe 2.08: Domain d5ty3a_: 5ty3 A:

Lineage for d5ty3a_ (5ty3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109644] (13 PDB entries)
   Uniprot P99999

8. Domain d5ty3a_: 5ty3 A: [338671]
   automated match to d3zcfa_
   complexed with hec, so4

Details for d5ty3a_

PDB Entry: 5ty3, 1.25 Å

PDB Description: crystal structure of k72a variant of human cytochrome c

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d5ty3a_:

Sequence; same for both SEQRES and ATOM records:

>d5ty3a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpakyipgtkmifvgikkkeeradliaylkkatne

Timeline for d5ty3a_:

• d5ty3a_ first appeared in SCOPe 2.06
  
• d5ty3a_ appears in SCOPe 2.07