Lineage for d5t3ma_ (5t3m A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030282Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 3030323Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 3030412Protein automated matches [254476] (10 species)
    not a true protein
  7. 3030426Species Haplopelma schmidti [TaxId:29017] [255481] (4 PDB entries)
  8. 3030428Domain d5t3ma_: 5t3m A: [338654]
    automated match to d2mpqa_
    mutant

Details for d5t3ma_

PDB Entry: 5t3m (more details)

PDB Description: solution structure of a triple mutant of hwtx-iv - a potent blocker of nav1.7
PDB Compounds: (A:) Mu-theraphotoxin-Hs2a

SCOPe Domain Sequences for d5t3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3ma_ g.3.6.2 (A:) automated matches {Haplopelma schmidti [TaxId: 29017]}
gclgifkacnpsndqcckssklvcsrktrwckwqi

SCOPe Domain Coordinates for d5t3ma_:

Click to download the PDB-style file with coordinates for d5t3ma_.
(The format of our PDB-style files is described here.)

Timeline for d5t3ma_: