Lineage for d2mpqa_ (2mpq A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030282Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 3030323Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 3030412Protein automated matches [254476] (10 species)
    not a true protein
  7. 3030421Species Haplopelma doriae [TaxId:1046906] [270273] (1 PDB entry)
  8. 3030422Domain d2mpqa_: 2mpq A: [270274]
    automated match to d1niya_

Details for d2mpqa_

PDB Entry: 2mpq (more details)

PDB Description: solution structure of the sodium channel toxin hd1a
PDB Compounds: (A:) Hd1a

SCOPe Domain Sequences for d2mpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpqa_ g.3.6.2 (A:) automated matches {Haplopelma doriae [TaxId: 1046906]}
gaclgfgkscnpsndqcckssslacstkhkwckyel

SCOPe Domain Coordinates for d2mpqa_:

Click to download the PDB-style file with coordinates for d2mpqa_.
(The format of our PDB-style files is described here.)

Timeline for d2mpqa_: