SCOPe 2.07: Domain d5h2fx_: 5h2f X:

Lineage for d5h2fx_ (5h2f X:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries)

8. Domain d5h2fx_: 5h2f X: [338560]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fz_
   automated match to d4ub8x_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fx_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d5h2fx_:

Sequence; same for both SEQRES and ATOM records:

>d5h2fx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvq

Timeline for d5h2fx_:

• d5h2fx_ first appeared in SCOPe 2.06
  
• d5h2fx_ appears in the current release, SCOPe 2.08