SCOPe 2.07: Domain d5h2fu_: 5h2f u:

Lineage for d5h2fu_ (5h2f u:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [158541] (3 PDB entries)
   Uniprot Q9F1L5 37-134

8. Domain d5h2fu_: 5h2f u: [332319]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
   automated match to d2axtu1
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fu_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5h2fu_:

Sequence; same for both SEQRES and ATOM records:

>d5h2fu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5h2fu_:

• d5h2fu_ first appeared in SCOPe 2.06
  
• d5h2fu_ appears in the current release, SCOPe 2.08