SCOPe 2.07: Domain d5h2fh_: 5h2f H:

Lineage for d5h2fh_ (5h2f H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
   Uniprot Q8DJ43 2-65

8. Domain d5h2fh_: 5h2f H: [338461]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
   automated match to d4pj0h_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fh_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5h2fh_:

Sequence; same for both SEQRES and ATOM records:

>d5h2fh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

Timeline for d5h2fh_:

• d5h2fh_ first appeared in SCOPe 2.06
  
• d5h2fh_ appears in the current release, SCOPe 2.08