Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins) |
Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53212] (4 PDB entries) |
Domain d1cx8d3: 1cx8 D:122-189,D:383-608 [33854] Other proteins in same PDB: d1cx8a1, d1cx8a2, d1cx8b1, d1cx8b2, d1cx8c1, d1cx8c2, d1cx8d1, d1cx8d2, d1cx8e1, d1cx8e2, d1cx8f1, d1cx8f2, d1cx8g1, d1cx8g2, d1cx8h1, d1cx8h2 complexed with nag, sm |
PDB Entry: 1cx8 (more details), 3.2 Å
SCOPe Domain Sequences for d1cx8d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx8d3 c.56.5.5 (D:122-189,D:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]} lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln
Timeline for d1cx8d3: