Lineage for d1cx8c1 (1cx8 C:609-760)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327716Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2327748Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2327749Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2327789Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)
  7. 2327790Species Human (Homo sapiens) [TaxId:9606] [47675] (4 PDB entries)
  8. 2327797Domain d1cx8c1: 1cx8 C:609-760 [17784]
    Other proteins in same PDB: d1cx8a2, d1cx8a3, d1cx8b2, d1cx8b3, d1cx8c2, d1cx8c3, d1cx8d2, d1cx8d3, d1cx8e2, d1cx8e3, d1cx8f2, d1cx8f3, d1cx8g2, d1cx8g3, d1cx8h2, d1cx8h3
    complexed with nag, sm

Details for d1cx8c1

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor
PDB Compounds: (C:) transferrin receptor protein

SCOPe Domain Sequences for d1cx8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8c1 a.48.2.1 (C:609-760) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdidnef

SCOPe Domain Coordinates for d1cx8c1:

Click to download the PDB-style file with coordinates for d1cx8c1.
(The format of our PDB-style files is described here.)

Timeline for d1cx8c1: