![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) ![]() automatically mapped to Pfam PF04253 |
![]() | Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins) |
![]() | Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47675] (4 PDB entries) |
![]() | Domain d1cx8g1: 1cx8 G:609-760 [17788] Other proteins in same PDB: d1cx8a2, d1cx8a3, d1cx8b2, d1cx8b3, d1cx8c2, d1cx8c3, d1cx8d2, d1cx8d3, d1cx8e2, d1cx8e3, d1cx8f2, d1cx8f3, d1cx8g2, d1cx8g3, d1cx8h2, d1cx8h3 complexed with nag, sm |
PDB Entry: 1cx8 (more details), 3.2 Å
SCOPe Domain Sequences for d1cx8g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx8g1 a.48.2.1 (G:609-760) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne tlfrnqlalatwtiqgaanalsgdvwdidnef
Timeline for d1cx8g1: