Lineage for d5gqda2 (5gqd A:304-427)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401985Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)
  8. 2401996Domain d5gqda2: 5gqd A:304-427 [337561]
    Other proteins in same PDB: d5gqda1, d5gqdb1
    automated match to d2d1za2
    complexed with gol, xyp, xys; mutant

Details for d5gqda2

PDB Entry: 5gqd (more details), 1.8 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e- 86
PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d5gqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gqda2 b.42.2.0 (A:304-427) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOPe Domain Coordinates for d5gqda2:

Click to download the PDB-style file with coordinates for d5gqda2.
(The format of our PDB-style files is described here.)

Timeline for d5gqda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gqda1