SCOPe 2.06: Domain d5gqda2: 5gqd A:304-427

Lineage for d5gqda2 (5gqd A:304-427)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)

8. Domain d5gqda2: 5gqd A:304-427 [337561]
   Other proteins in same PDB: d5gqda1, d5gqdb1
   automated match to d2d1za2
   complexed with gol, xyp, xys; mutant

Details for d5gqda2

PDB Entry: 5gqd, 1.8 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e- 86

PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d5gqda2:

Sequence; same for both SEQRES and ATOM records:

>d5gqda2 b.42.2.0 (A:304-427) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

Timeline for d5gqda2:

• d5gqda2 is new in SCOPe 2.06-stable
  
• d5gqda2 appears in SCOPe 2.07
  
• d5gqda2 appears in the current release, SCOPe 2.08