SCOPe 2.06: Domain d5wtab1: 5wta B:272-418

Lineage for d5wtab1 (5wta B:272-418)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [336878] (1 PDB entry)

8. Domain d5wtab1: 5wta B:272-418 [336923]
   automated match to d1r17a1

Details for d5wtab1

PDB Entry: 5wta, 2.3 Å

PDB Description: crystal structure of staphylococcus aureus sdre apo form

PDB Compounds: (B:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5wtab1:

Sequence; same for both SEQRES and ATOM records:

>d5wtab1 b.2.3.0 (B:272-418) automated matches {Staphylococcus aureus [TaxId: 158878]}
snnvndlitvtkqtikvgdgkdnvaaahdgkdieydteftidnkvkkgdtmtinydknvi
psdltdkndpiditdpsgeviakgtfdkatkqitytftdyvdkyedikarltlysyidkq
avpnetslnltfatagketsqnvsvdy

Timeline for d5wtab1:

• d5wtab1 is new in SCOPe 2.06-stable
  
• d5wtab1 appears in SCOPe 2.07
  
• d5wtab1 appears in the current release, SCOPe 2.08