Lineage for d5wtac2 (5wta C:419-586)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040890Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2040891Protein automated matches [190503] (6 species)
    not a true protein
  7. 2040919Species Staphylococcus aureus [TaxId:158878] [336878] (1 PDB entry)
  8. 2040925Domain d5wtac2: 5wta C:419-586 [336902]
    automated match to d1r17a2

Details for d5wtac2

PDB Entry: 5wta (more details), 2.3 Å

PDB Description: crystal structure of staphylococcus aureus sdre apo form
PDB Compounds: (C:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5wtac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtac2 b.2.3.0 (C:419-586) automated matches {Staphylococcus aureus [TaxId: 158878]}
qdpmvhgdsniqsiftkldenkqtieqqiyvnplkktatntkvdiagsqvddygniklgn
gstiidqntemkvykvnpnqqlpqsnriydfsqyedvtsqfdnkksfsnnvatldfgdin
sayiikvvskytptsdgeldiaqgtsmrttdkygyynyagysnfivts

SCOPe Domain Coordinates for d5wtac2:

Click to download the PDB-style file with coordinates for d5wtac2.
(The format of our PDB-style files is described here.)

Timeline for d5wtac2: