Lineage for d1bisb_ (1bis B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886120Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)
  8. 2886145Domain d1bisb_: 1bis B: [33651]

Details for d1bisb_

PDB Entry: 1bis (more details), 1.95 Å

PDB Description: hiv-1 integrase core domain
PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1bisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bisb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d1bisb_:

Click to download the PDB-style file with coordinates for d1bisb_.
(The format of our PDB-style files is described here.)

Timeline for d1bisb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bisa_