SCOPe 2.07: Domain d1bisb_: 1bis B:

Lineage for d1bisb_ (1bis B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)

8. Domain d1bisb_: 1bis B: [33651]

Details for d1bisb_

PDB Entry: 1bis, 1.95 Å

PDB Description: hiv-1 integrase core domain

PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1bisb_:

Sequence; same for both SEQRES and ATOM records:

>d1bisb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Timeline for d1bisb_:

• d1bisb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bisb_ appears in SCOPe 2.06
  
• d1bisb_ appears in the current release, SCOPe 2.08