SCOP 1.63: Domain d1exqa_: 1exq A:

Lineage for d1exqa_ (1exq A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (17 PDB entries)

8. Domain d1exqa_: 1exq A: [33646]

Details for d1exqa_

PDB Entry: 1exq, 1.6 Å

PDB Description: crystal structure of the hiv-1 integrase catalytic core domain

SCOP Domain Sequences for d1exqa_:

Sequence, based on SEQRES records:

>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipyvesmnkelkkiigqvrdqaehlktavqmavfi
hnkkrkggiggysagerivdiiatdiq

Timeline for d1exqa_:

• d1exqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1exqa_ appears in SCOP 1.61
  
• d1exqa_ appears in SCOP 1.65
  
• d1exqa_ appears in the current release, SCOPe 2.08