Lineage for d1exqa_ (1exq A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)
  8. Domain d1exqa_: 1exq A: [33646]
    complexed with cd, cl, so4

Details for d1exqa_

PDB Entry: 1exq (more details), 1.6 Å

PDB Description: crystal structure of the hiv-1 integrase catalytic core domain
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1exqa_:

Sequence, based on SEQRES records: (download)

>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipyvesmnkelkkiigqvrdqaehlktavqmavfi
hnkkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d1exqa_ are not available.

Timeline for d1exqa_:

Domains from other chains:
(mouse over for more information)
d1exqb_